PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400022870
Common NameLOC102589921
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family ZF-HD
Protein Properties Length: 241aa    MW: 26732.6 Da    PI: 7.5205
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400022870genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer106.31.8e-3344101260
           ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                           ++vrY+eClkNhA+ +Ggha+DGCgEfmp+ geegt++alkCaAC+CHRnFHR+e e e
  PGSC0003DMP400022870  44 SNVRYRECLKNHAVGIGGHALDGCGEFMPA-GEEGTMDALKCAACNCHRNFHRKEAEGE 101
                           689**************************9.999*********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047704.0E-304598IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257743.0E-234799IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.5E-304797IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.9984897IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.63E-20163238IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.0E-31165239IPR009057Homeodomain-like
TIGRFAMsTIGR015651.5E-24177233IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MEFDEDHEEQ EQEIGAAGVE NYVTTGNNSG REEGISPSSI GRKSNVRYRE CLKNHAVGIG  60
GHALDGCGEF MPAGEEGTMD ALKCAACNCH RNFHRKEAEG EVFHHTPPPH LTHHHHPQFS  120
PFSSYRTTHH PSGYLHVNQL PHQRPLALPS TSRDDEDMSN PSSSGGGGGS GGVGGSRKRF  180
RTKFTGDQKD KMLAFAERLG WRMQKQDEAL VQQFCAETNI KRHVFKVWMH NNKHTLGKKP  240
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A6e-261782351875ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755160.0HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006338094.10.0PREDICTED: zinc-finger homeodomain protein 2
SwissprotQ6YXH53e-76ZHD1_ORYSJ; Zinc-finger homeodomain protein 1
TrEMBLM1AZE80.0M1AZE8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000336240.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.11e-67homeobox protein 22
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]